RetrogeneDB ID: | retro_ggor_1104 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 14:48760718..48760942(-) | ||
Located in intron of: | ENSGGOG00000005620 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX7A2 | ||
Ensembl ID: | ENSGGOG00000005865 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 55.26 % |
Parental protein coverage: | 65.22 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | VFSCGGCWSVTPKMLRNLLALRQIGQRTISTASRRHFKNKVPE-KQKLFQEDDEIPLYLKGGIADALLYR |
..SC.G.W.VT...........Q..QRT.S.AS.RHF.NK.PE.K.KLFQE...IP..LKGG.AD.LLYR | |
Retrocopy | LWSCQGSWAVTESRCCRICWHCQVAQRTMSIASCRHFENKGPE<KHKLFQEKNGIPVHLKGGRADDLLYR |
Parental | ATMILT |
ATM.L. | |
Retrocopy | ATMVLS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 53 .85 RPM |
SRP007412_cerebellum | 0 .12 RPM | 36 .96 RPM |
SRP007412_heart | 0 .03 RPM | 64 .45 RPM |
SRP007412_kidney | 0 .12 RPM | 92 .16 RPM |
SRP007412_liver | 0 .13 RPM | 39 .57 RPM |
SRP007412_testis | 0 .00 RPM | 116 .55 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1434 |
Pongo abelii | retro_pabe_1187 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014453 | 1 retrocopy | |
Bos taurus | ENSBTAG00000005096 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000010305 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000007404 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000015425 | 2 retrocopies | |
Homo sapiens | ENSG00000112695 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000005865 | 2 retrocopies |
retro_ggor_1104 , retro_ggor_2051,
|
Gorilla gorilla | ENSGGOG00000010739 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000002313 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000015747 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004949 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000016781 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000010401 | 6 retrocopies | |
Rattus norvegicus | ENSRNOG00000042903 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000004480 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002536 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000007294 | 7 retrocopies | |
Tursiops truncatus | ENSTTRG00000007874 | 1 retrocopy |