RetrogeneDB ID: | retro_btau_818 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 2:44917638..44917795(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MP68 | ||
| Ensembl ID: | ENSBTAG00000026886 | ||
| Aliases: | C21H14orf2, MLQ, MP68 | ||
| Description: | 6.8 kDa mitochondrial proteolipid [Source:UniProtKB/Swiss-Prot;Acc:P14790] |
| Percent Identity: | 66.04 % |
| Parental protein coverage: | 86.67 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | VWIP-MKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASSAAPAHGHH |
| VWIP..KPY.TQ.YQEIWVGT.LM..IVYK..SA.KR..ALKAS....AH..H | |
| Retrocopy | VWIP>VKPY*TQVYQEIWVGTRLMDFIVYKTKSANKRN*ALKASGPRSAHSQH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 24 .22 RPM |
| ERP005899_muscle | 0 .00 RPM | 90 .27 RPM |
| SRP017611_brain | 0 .00 RPM | 15 .76 RPM |
| SRP017611_kidney | 0 .00 RPM | 44 .34 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .84 RPM |
| SRP030211_testis | 0 .01 RPM | 61 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000026886 | 4 retrocopies | |
| Homo sapiens | ENSG00000156411 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002297 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016248 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006764 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011548 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000043144 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000002550 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008996 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006404 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000001249 | 7 retrocopies |