RetrogeneDB ID: | retro_mputfur_243 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896899.1:19589734..19589913(-) | ||
| Located in intron of: | ENSMPUG00000017001 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C14orf2 | ||
| Ensembl ID: | ENSMPUG00000002297 | ||
| Aliases: | None | ||
| Description: | chromosome 14 open reading frame 2 [Source:HGNC Symbol;Acc:1188] |
| Percent Identity: | 62.3 % |
| Parental protein coverage: | 98.33 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | LQSFIKNVWIPLKPY-YTQVYQEIWVGMGL-MSVIIYKIRSADKRSKALKASSPAPAHGHH |
| L.S.IKNVWIP.KP...T.VYQEIWVGM.L.M..I..KIR...K.SK...A.SP.PA.GHH | |
| Retrocopy | LFSLIKNVWIPVKPC>HT*VYQEIWVGMEL>MAFIF*KIRNVGKKSKYFRALSPTPARGHH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000026886 | 4 retrocopies | |
| Homo sapiens | ENSG00000156411 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002297 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016248 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006764 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011548 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000043144 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000002550 | 5 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008996 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006404 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000001249 | 7 retrocopies |