RetrogeneDB ID: | retro_cfam_1487 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 32:1751985..1752375(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | KRTCAP2 | ||
Ensembl ID: | ENSCAFG00000017055 | ||
Aliases: | KRTCAP2, KCP-2, KCP2 | ||
Description: | Canis lupus familiaris keratinocyte associated protein 2 (KRTCAP2), mRNA. [Source:RefSeq mRNA;Acc:NM_001160122] |
Percent Identity: | 74.44 % |
Parental protein coverage: | 95.59 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | TSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQG-GLL-GSGLFVFSLTAFNNLENLVFGKGFQAKIFPE |
T..AL.S..SL.LFAGM..YS.QLAS..WLTI.G.G.L.GS.L.VFSLTAF.NL.N.VFGKGFQAKIFPE | |
Retrocopy | TVMALFSPQSLMLFAGMHIYSLQLASPKWLTIKG<GRLLGSSLLVFSLTAFSNLMNVVFGKGFQAKIFPE |
Parental | ILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAATPVLTPAKVT-GKGKKRN |
ILLCLLLALFASGLIH.VCV.TCF.F.MVGL.YINKISS.LYQ...P.LTPAK.T.GK.KKR. | |
Retrocopy | ILLCLLLALFASGLIHQVCVRTCFTFFMVGLNYINKISS-LYQVTVPFLTPAKIT>GKSKKRS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 71 .02 RPM |
SRP017611_brain | 0 .00 RPM | 16 .04 RPM |
SRP017611_kidney | 0 .00 RPM | 69 .47 RPM |
SRP017611_liver | 0 .00 RPM | 22 .48 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011336 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000017055 | 1 retrocopy |
retro_cfam_1487 ,
|
Callithrix jacchus | ENSCJAG00000009017 | 1 retrocopy | |
Felis catus | ENSFCAG00000025085 | 3 retrocopies | |
Homo sapiens | ENSG00000163463 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009303 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012180 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000005647 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011864 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000347 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000030271 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000756 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001410 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000020542 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008829 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013228 | 2 retrocopies |