RetrogeneDB ID: | retro_mmul_745 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1099214785412:1173..1417(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | KRTCAP2 | ||
| Ensembl ID: | ENSMMUG00000012180 | ||
| Aliases: | None | ||
| Description: | keratinocyte associated protein 2 [Source:HGNC Symbol;Acc:28942] |
| Percent Identity: | 84.52 % |
| Parental protein coverage: | 50.62 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | FNNLENLVFGKGFQAKIF-PEILL-CLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPV |
| F..LE.LVFGKG.QAK.F.PEILL..LLLALFASGLIH.VCVTTCFIFS.VGL.YINKISSTL.QAAAPV | |
| Retrocopy | FKILETLVFGKGSQAKTF<PEILL<VLLLALFASGLIH*VCVTTCFIFSVVGLCYINKISSTLHQAAAPV |
| Parental | LTPAKVTGKSKKRN |
| LTPAKVTGKSKKR. | |
| Retrocopy | LTPAKVTGKSKKRH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 12 .66 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 16 .74 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 13 .95 RPM |
| SRP007412_heart | 0 .00 RPM | 22 .08 RPM |
| SRP007412_kidney | 0 .00 RPM | 37 .91 RPM |
| SRP007412_liver | 0 .00 RPM | 55 .77 RPM |
| SRP007412_testis | 0 .00 RPM | 84 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011336 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017055 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009017 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025085 | 3 retrocopies | |
| Homo sapiens | ENSG00000163463 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009303 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012180 | 2 retrocopies |
retro_mmul_745 , retro_mmul_987,
|
| Mustela putorius furo | ENSMPUG00000005647 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011864 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000347 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000030271 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000756 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001410 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020542 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008829 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013228 | 2 retrocopies |