RetrogeneDB ID: | retro_ptro_1541 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 2A:45693420..45693861(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | KRTCAP2 | ||
Ensembl ID: | ENSPTRG00000001410 | ||
Aliases: | None | ||
Description: | keratinocyte associated protein 2 [Source:HGNC Symbol;Acc:28942] |
Percent Identity: | 77.7 % |
Parental protein coverage: | 91.36 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | LARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNN |
L.RGA..TH..GMMVVGT.TSLA.SSLLSLLLF.GMQM...QLAST.WLTI.GGL.GSGLFV.SLTAF.. | |
Retrocopy | LVRGANLTHRQGMMVVGTDTSLAISSLLSLLLFTGMQM*IHQLAST*WLTIHGGLHGSGLFVLSLTAFKI |
Parental | LENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMIGLYYINKISSTLYQAAAPVLTPAK |
LENLVFGKG.QA..FPEILLCLLLALFASGLIHRVCVTTCFIFS.IGL.YINKI.STLYQAAA.VLT... | |
Retrocopy | LENLVFGKGSQANTFPEILLCLLLALFASGLIHRVCVTTCFIFSVIGLCYINKI-STLYQAAAAVLTGPW |
Parental | VTGKSKKR |
....S..R | |
Retrocopy | LLPRSQAR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 25 .63 RPM |
SRP007412_cerebellum | 0 .00 RPM | 15 .52 RPM |
SRP007412_heart | 0 .12 RPM | 16 .35 RPM |
SRP007412_kidney | 0 .05 RPM | 44 .54 RPM |
SRP007412_liver | 0 .03 RPM | 37 .64 RPM |
SRP007412_testis | 0 .95 RPM | 76 .19 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2100 |
Gorilla gorilla | retro_ggor_1635 |
Pongo abelii | retro_pabe_1999 |
Macaca mulatta | retro_mmul_987 |
Callithrix jacchus | retro_cjac_1289 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011336 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000017055 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009017 | 1 retrocopy | |
Felis catus | ENSFCAG00000025085 | 3 retrocopies | |
Homo sapiens | ENSG00000163463 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009303 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012180 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000005647 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011864 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000347 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000030271 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000000756 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001410 | 1 retrocopy |
retro_ptro_1541 ,
|
Rattus norvegicus | ENSRNOG00000020542 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008829 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013228 | 2 retrocopies |