RetrogeneDB ID: | retro_cfam_1570 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 35:19236826..19237013(+) | ||
| Located in intron of: | ENSCAFG00000010226 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PTMA | ||
| Ensembl ID: | ENSCAFG00000032596 | ||
| Aliases: | None | ||
| Description: | Canis lupus familiaris prothymosin, alpha (PTMA), mRNA. [Source:RefSeq mRNA;Acc:NM_001252198] |
| Percent Identity: | 52.31 % |
| Parental protein coverage: | 56.76 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | ADNEVDEEEEE-GGEEEEEEEEGDGEEEDGDEDEEAEAATGKRAAEDDEDDDVDTKKQ-KTDEDD |
| A....DEE..E..G........G....E.GD.DEEAE....K.AA.D.EDDDVDTKKQ.KTDED. | |
| Retrocopy | ASGDADEESGE<AGGHQWGLGPGEEDQEGGDDDEEAEVDWSKWAAGDVEDDDVDTKKQ<KTDEDN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 592 .31 RPM |
| SRP017611_brain | 0 .00 RPM | 212 .06 RPM |
| SRP017611_kidney | 0 .00 RPM | 278 .28 RPM |
| SRP017611_liver | 0 .00 RPM | 163 .45 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Sus scrofa | retro_sscr_895 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002549 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000032596 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013611 | 9 retrocopies | |
| Felis catus | ENSFCAG00000004780 | 1 retrocopy | |
| Homo sapiens | ENSG00000187514 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009874 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002628 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012140 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026238 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014135 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018584 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000023690 | 1 retrocopy |