RetrogeneDB ID: | retro_ggor_2149 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 5:6564354..6564650(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENSG00000197744 | ||
Ensembl ID: | ENSGGOG00000009874 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67. % |
Parental protein coverage: | 85.45 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MSDAAVDTSSEITTKDLKEKKEVVEEAE-NGRDAPANGNANEENGEQEADNEVDEEEEEG-GEEEEEEEE |
MSDAA.DTSSEITTKDLKEKKEVVEEAE.NGRDA.ANGNANEEN.EQE.DNEVDEEEEEG.GEEE...E. | |
Retrocopy | MSDAAIDTSSEITTKDLKEKKEVVEEAE<NGRDASANGNANEENWEQEVDNEVDEEEEEGDGEEEDGDED |
Parental | GDGEEEDG----DEDEEAESATGKRAAEDD |
...E...G......DE.....T.K.....D | |
Retrocopy | EEAEFATGK*AAEDDEDDDVDTKKQKIDED |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 176 .71 RPM |
SRP007412_cerebellum | 0 .04 RPM | 111 .34 RPM |
SRP007412_heart | 0 .00 RPM | 64 .17 RPM |
SRP007412_kidney | 0 .08 RPM | 191 .40 RPM |
SRP007412_liver | 0 .00 RPM | 107 .31 RPM |
SRP007412_testis | 0 .41 RPM | 113 .86 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1863 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000002549 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000032596 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000013611 | 9 retrocopies | |
Felis catus | ENSFCAG00000004780 | 1 retrocopy | |
Homo sapiens | ENSG00000187514 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000009874 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000002628 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000012140 | 1 retrocopy | |
Mus musculus | ENSMUSG00000026238 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000014135 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000018584 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000023690 | 1 retrocopy |