RetrogeneDB ID: | retro_cfam_1975 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 9:20333089..20333331(+) | ||
| Located in intron of: | ENSCAFG00000014890 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPF | ||
| Ensembl ID: | ENSCAFG00000006395 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide F [Source:HGNC Symbol;Acc:11162] |
| Percent Identity: | 93.9 % |
| Parental protein coverage: | 72.97 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | NPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGV |
| NPKPFLNGLTGKPV.VKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRC.NVLYIRGV | |
| Retrocopy | NPKPFLNGLTGKPVTVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCHNVLYIRGV |
| Parental | -EEEEEDGEMRE |
| .EEE.EDGE.RE | |
| Retrocopy | <EEE*EDGEVRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 10 .96 RPM |
| SRP017611_brain | 0 .00 RPM | 3 .97 RPM |
| SRP017611_kidney | 0 .00 RPM | 14 .66 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000006395 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002705 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000013509 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000001558 | 3 retrocopies | |
| Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
| Latimeria chalumnae | ENSLACG00000002456 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000017426 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000008091 | 3 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000016462 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000012294 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006837 | 4 retrocopies |