RetrogeneDB ID: | retro_cjac_1260 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 14:15105713..15106178(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LYPLA1 | ||
Ensembl ID: | ENSCJAG00000011562 | ||
Aliases: | None | ||
Description: | lysophospholipase I [Source:HGNC Symbol;Acc:6737] |
Percent Identity: | 70.7 % |
Parental protein coverage: | 67.39 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | HAPVMPVTLNMNMAMPSWFDIIGLSPDSQEDEPGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGAL |
...VMP..LNM..AM.SW.D...L..DS...EPGIKQA..N.KALI.QEVKNGI..NRI.LGGFSQGGAL | |
Retrocopy | YVTVMPTALNMSLAMTSWLDFLRLLLDSWKGEPGIKQAVKNVKALINQEVKNGISYNRIVLGGFSQGGAL |
Parental | -SLYTALTMQQKLAGVTALSCWLPLRASFPQGPI-SGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTL |
.SLYT.LT.QQKLA.VTALSCWLPL...F.QGPI..G.NRDISILQC..DCDPLV.LMF..LTVE.LK.L | |
Retrocopy | >SLYTSLTTQQKLACVTALSCWLPLCDPFLQGPI<CGTNRDISILQCRKDCDPLVSLMFDLLTVENLKAL |
Parental | VNPANVTFKTYEGMMHS |
VNPA.V.FKT..GMMHS | |
Retrocopy | VNPASVNFKTFIGMMHS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 30 .60 RPM |
SRP051959_heart | 0 .00 RPM | 22 .87 RPM |
SRP051959_kidney | 0 .00 RPM | 40 .80 RPM |
SRP051959_liver | 0 .00 RPM | 37 .15 RPM |
SRP051959_lung | 0 .00 RPM | 22 .21 RPM |
SRP051959_lymph_node | 0 .00 RPM | 17 .01 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 23 .78 RPM |
SRP051959_spleen | 0 .00 RPM | 20 .61 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000006978 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000011562 | 2 retrocopies |
retro_cjac_1260 , retro_cjac_3100,
|
Callithrix jacchus | ENSCJAG00000020914 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000022715 | 3 retrocopies | |
Dipodomys ordii | ENSDORG00000001479 | 1 retrocopy | |
Equus caballus | ENSECAG00000016530 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000001727 | 2 retrocopies | |
Homo sapiens | ENSG00000120992 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000008208 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000013157 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000001027 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006751 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000018590 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000005246 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000008320 | 3 retrocopies | |
Tarsius syrichta | ENSTSYG00000012350 | 6 retrocopies | |
Tursiops truncatus | ENSTTRG00000011836 | 3 retrocopies |