RetrogeneDB ID: | retro_cjac_2110 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 22:29589905..29590266(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSMB2 | ||
Ensembl ID: | ENSCJAG00000001547 | ||
Aliases: | None | ||
Description: | proteasome (prosome, macropain) subunit, beta type, 2 [Source:HGNC Symbol;Acc:9539] |
Percent Identity: | 78.86 % |
Parental protein coverage: | 52.14 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | PSFARRCCLTGETGKSARLALCRTWSPWPPATMEYLIGIQGPDYVLVASDRVAASNIVQMKDADHDKMFK |
PSF..RCCLTGET.K.....LC.T.SPWPPAT.EYLIGIQGPDY.LV.SDRVAASNIVQMKD..HDKMFK | |
Retrocopy | PSFTQRCCLTGETRKPVSVVLCLTCSPWPPATVEYLIGIQGPDYALVTSDRVAASNIVQMKD-NHDKMFK |
Parental | MSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMR-NGYELSPTAAANFTRRNLA |
MSEKILLLCVG.AG.T.QFAEY.QK.V.LYKMR.NGYE.SPTAA.NFT..NLA | |
Retrocopy | MSEKILLLCVGKAGNT-QFAEYFQKKVLLYKMR>NGYESSPTAATNFTHGNLA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .02 RPM | 14 .20 RPM |
SRP051959_heart | 0 .02 RPM | 10 .26 RPM |
SRP051959_kidney | 0 .00 RPM | 13 .02 RPM |
SRP051959_liver | 0 .00 RPM | 18 .48 RPM |
SRP051959_lung | 0 .02 RPM | 10 .74 RPM |
SRP051959_lymph_node | 0 .02 RPM | 12 .47 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 18 .80 RPM |
SRP051959_spleen | 0 .02 RPM | 17 .06 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000715 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000003543 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001547 | 1 retrocopy |
retro_cjac_2110 ,
|
Dasypus novemcinctus | ENSDNOG00000017663 | 1 retrocopy | |
Equus caballus | ENSECAG00000021615 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019511 | 1 retrocopy | |
Felis catus | ENSFCAG00000030845 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000000421 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017902 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000014891 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000012259 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000001871 | 1 retrocopy | |
Sorex araneus | ENSSARG00000000409 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000016996 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005230 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000005648 | 2 retrocopies |