RetrogeneDB ID: | retro_fcat_1803 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | F2:19238466..19238862(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PSMB2 | ||
Ensembl ID: | ENSFCAG00000030845 | ||
Aliases: | None | ||
Description: | proteasome (prosome, macropain) subunit, beta type, 2 [Source:HGNC Symbol;Acc:9539] |
Percent Identity: | 75.56 % |
Parental protein coverage: | 67.16 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | VLVASDQVAASSIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAAN |
..VASDQVAA..IVQMKDDHDK.F..SE.IL.LCVGE.GDTVQFAEYIQKNVQLYKM.NGYELSPTAAAN | |
Retrocopy | IFVASDQVAANRIVQMKDDHDKTFQRSEEILFLCVGETGDTVQFAEYIQKNVQLYKM*NGYELSPTAAAN |
Parental | FTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYY |
FT..N.AD.L.SR.P.HVNLLL..Y.EHE.PA.YYM.YLAALAKA..AA.G...FLT.S.LDR.Y | |
Retrocopy | FTW*NPADYLQSRIPNHVNLLLVDYNEHEDPAPYYMAYLAALAKASSAARG---FLTHSRLDRSY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 27 .66 RPM |
SRP017611_kidney | 0 .00 RPM | 29 .47 RPM |
SRP017611_liver | 0 .00 RPM | 29 .62 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000715 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000003543 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000001547 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000017663 | 1 retrocopy | |
Equus caballus | ENSECAG00000021615 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019511 | 1 retrocopy | |
Felis catus | ENSFCAG00000030845 | 1 retrocopy |
retro_fcat_1803 ,
|
Macropus eugenii | ENSMEUG00000000421 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017902 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000014891 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000012259 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000001871 | 1 retrocopy | |
Sorex araneus | ENSSARG00000000409 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000016996 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005230 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000005648 | 2 retrocopies |