RetrogeneDB ID: | retro_fcat_1803 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | F2:19238466..19238862(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PSMB2 | ||
| Ensembl ID: | ENSFCAG00000030845 | ||
| Aliases: | None | ||
| Description: | proteasome (prosome, macropain) subunit, beta type, 2 [Source:HGNC Symbol;Acc:9539] |
| Percent Identity: | 75.56 % |
| Parental protein coverage: | 67.16 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | VLVASDQVAASSIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAAN |
| ..VASDQVAA..IVQMKDDHDK.F..SE.IL.LCVGE.GDTVQFAEYIQKNVQLYKM.NGYELSPTAAAN | |
| Retrocopy | IFVASDQVAANRIVQMKDDHDKTFQRSEEILFLCVGETGDTVQFAEYIQKNVQLYKM*NGYELSPTAAAN |
| Parental | FTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYY |
| FT..N.AD.L.SR.P.HVNLLL..Y.EHE.PA.YYM.YLAALAKA..AA.G...FLT.S.LDR.Y | |
| Retrocopy | FTW*NPADYLQSRIPNHVNLLLVDYNEHEDPAPYYMAYLAALAKASSAARG---FLTHSRLDRSY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .66 RPM |
| SRP017611_kidney | 0 .00 RPM | 29 .47 RPM |
| SRP017611_liver | 0 .00 RPM | 29 .62 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000715 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000003543 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001547 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017663 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021615 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019511 | 1 retrocopy | |
| Felis catus | ENSFCAG00000030845 | 1 retrocopy |
retro_fcat_1803 ,
|
| Macropus eugenii | ENSMEUG00000000421 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017902 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000014891 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012259 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001871 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000000409 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000016996 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005230 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005648 | 2 retrocopies |