RetrogeneDB ID: | retro_dnov_159 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_2222:66416..66814(+) | ||
| Located in intron of: | ENSDNOG00000013415 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PSMB2 | ||
| Ensembl ID: | ENSDNOG00000017663 | ||
| Aliases: | None | ||
| Description: | proteasome (prosome, macropain) subunit, beta type, 2 [Source:HGNC Symbol;Acc:9539] |
| Percent Identity: | 77.78 % |
| Parental protein coverage: | 99.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | HDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNXXXXXXTAAANFTRRNL-DCLRSRTPYHVN |
| H.KMFKMSEKILLL.VGEAGD.VQF..YIQKNVQLYKM.N......T.AANFT.RNL.DCL.SRTPYHV. | |
| Retrocopy | HNKMFKMSEKILLLRVGEAGDPVQFTGYIQKNVQLYKMINGYELSPTVAANFTHRNLADCLQSRTPYHVS |
| Parental | LLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTP-TISRERAVELLRKCLE |
| LL.AG.DEHEGPALYYMDYLAALAK.PFAA.GYGAF.TLSILD..Y.P.T.S.ERAVELL..CLE | |
| Retrocopy | LL-AGNDEHEGPALYYMDYLAALAKGPFAAQGYGAFFTLSILDQCYIP<TLSHERAVELLGNCLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 2 .72 RPM | 71 .18 RPM |
| SRP012922_cerebellum | 2 .06 RPM | 41 .10 RPM |
| SRP012922_heart | 2 .09 RPM | 48 .26 RPM |
| SRP012922_kidney | 2 .19 RPM | 58 .32 RPM |
| SRP012922_liver | 1 .39 RPM | 41 .95 RPM |
| SRP012922_lung | 2 .14 RPM | 45 .05 RPM |
| SRP012922_quadricep_muscle | 1 .04 RPM | 43 .96 RPM |
| SRP012922_spleen | 3 .89 RPM | 78 .75 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000715 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000003543 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001547 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017663 | 1 retrocopy |
retro_dnov_159 ,
|
| Equus caballus | ENSECAG00000021615 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019511 | 1 retrocopy | |
| Felis catus | ENSFCAG00000030845 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000421 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017902 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000014891 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012259 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000001871 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000000409 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000016996 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005230 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005648 | 2 retrocopies |