RetrogeneDB ID: | retro_cjac_2600 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 5:26508447..26508692(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CMC1 | ||
Ensembl ID: | ENSCJAG00000004272 | ||
Aliases: | None | ||
Description: | COX assembly mitochondrial protein 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28783] |
Percent Identity: | 67.47 % |
Parental protein coverage: | 77.36 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | EKARERCSEQIQDFTKCCQDSGVLMVIKCRKENSALKECLTAYYTDPAF-YEECKMEYLKEREEFRRTGI |
E...ERCSE...DF..C...S...MV.KC.KENSALKE.L..YY.DPAF..E.CKMEYLK.RE.FRRTG. | |
Retrocopy | ENRTERCSEPVPDFANCFKNSRIFMVVKCQKENSALKEWLINYYNDPAF<LEGCKMEYLKKREGFRRTGV |
Parental | PAKKRLQKLPTSM |
P.KKRLQKLPTSM | |
Retrocopy | PTKKRLQKLPTSM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 3 .77 RPM |
SRP051959_heart | 0 .00 RPM | 5 .05 RPM |
SRP051959_kidney | 0 .00 RPM | 4 .50 RPM |
SRP051959_liver | 0 .00 RPM | 4 .87 RPM |
SRP051959_lung | 0 .00 RPM | 6 .08 RPM |
SRP051959_lymph_node | 0 .05 RPM | 11 .46 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 3 .56 RPM |
SRP051959_spleen | 0 .00 RPM | 5 .36 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004272 | 2 retrocopies |
retro_cjac_2600 , retro_cjac_2653,
|
Dasypus novemcinctus | ENSDNOG00000018923 | 2 retrocopies | |
Homo sapiens | ENSG00000187118 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000012406 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000011702 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000044 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004066 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000012793 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000009474 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014054 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000014706 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000010149 | 1 retrocopy | |
Sorex araneus | ENSSARG00000001629 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002573 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000011371 | 2 retrocopies |