RetrogeneDB ID: | retro_pabe_2677 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:116535129..116535432(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CMC1 | ||
| Ensembl ID: | ENSPPYG00000014054 | ||
| Aliases: | None | ||
| Description: | COX assembly mitochondrial protein 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28783] |
| Percent Identity: | 71.84 % |
| Parental protein coverage: | 95.28 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | ADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKEC-LTAYYNDPAFY |
| A.Q.LR.VEKDVL.P.IMR..A.ER.SE.VQDFTKCCKNS..LMVVK..K.NSALK.C.LTAYYNDP.FY | |
| Retrocopy | AQQQLRYVEKDVLMPNIMRKMARERYSEKVQDFTKCCKNSRILMVVKYWKYNSALKDC>LTAYYNDPVFY |
| Parental | EECKMEYLKERE-EFRKTGIPAKKRLQKLPTSM |
| .E.KMEYLKE...E.RKTGI..K..LQKLP.SM | |
| Retrocopy | KEYKMEYLKECK<ELRKTGISTKLKLQKLPISM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .43 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .20 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .39 RPM |
| SRP007412_kidney | 0 .00 RPM | 5 .34 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .73 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3229 |
| Pan troglodytes | retro_ptro_2181 |
| Gorilla gorilla | retro_ggor_2196 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004272 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000018923 | 2 retrocopies | |
| Homo sapiens | ENSG00000187118 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012406 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000011702 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000044 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004066 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000012793 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009474 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014054 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000014706 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000010149 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001629 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002573 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011371 | 2 retrocopies |