RetrogeneDB ID: | retro_ptro_1207 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 17:8543445..8543676(-) | ||
Located in intron of: | ENSPTRG00000009368 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CMC1 | ||
Ensembl ID: | ENSPTRG00000014706 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 88.31 % |
Parental protein coverage: | 72.64 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | QHLRHVEKDVLIPKIMREKARERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEEC |
QHLRHVEKDV.IPKIMREKARERCSEQ.QDFTKCCKNSG.LMV.KC.KENS.LK..LTA.YNDPAFYEEC | |
Retrocopy | QHLRHVEKDVWIPKIMREKARERCSEQLQDFTKCCKNSGTLMVGKCWKENSLLKGRLTAHYNDPAFYEEC |
Parental | KMEYLKE |
KMEYLKE | |
Retrocopy | KMEYLKE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .95 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .72 RPM |
SRP007412_heart | 0 .00 RPM | 7 .32 RPM |
SRP007412_kidney | 0 .08 RPM | 6 .80 RPM |
SRP007412_liver | 0 .00 RPM | 6 .45 RPM |
SRP007412_testis | 0 .00 RPM | 9 .17 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1764 |
Gorilla gorilla | retro_ggor_2245 |
Pongo abelii | retro_pabe_1533 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004272 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000018923 | 2 retrocopies | |
Homo sapiens | ENSG00000187118 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000012406 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000011702 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000044 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004066 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000012793 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000009474 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014054 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000014706 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000010149 | 1 retrocopy | |
Sorex araneus | ENSSARG00000001629 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002573 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000011371 | 2 retrocopies |