RetrogeneDB ID: | retro_dnov_111 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_1676:87452..87692(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CMC1 | ||
| Ensembl ID: | ENSDNOG00000018923 | ||
| Aliases: | None | ||
| Description: | COX assembly mitochondrial protein 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28783] |
| Percent Identity: | 89.02 % |
| Parental protein coverage: | 51.25 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | PCPGAAERLSLAPPAEMALDPAEQHLRHVEKDVLIPKIMREKARERCSEQVQDFTKCCKDSGLLMVVKCR |
| PC.GAAE.LSLAPP.EMALD.AEQHLRHV.KDVLIPK..REKARERCSEQVQDFTK.CKDSGLLMVVKCR | |
| Retrocopy | PCQGAAEWLSLAPPIEMALD-AEQHLRHVKKDVLIPKT-REKARERCSEQVQDFTKYCKDSGLLMVVKCR |
| Parental | KENSALKECLTA |
| KENS.LKECLTA | |
| Retrocopy | KENSVLKECLTA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 2 .72 RPM | 21 .78 RPM |
| SRP012922_cerebellum | 1 .51 RPM | 11 .41 RPM |
| SRP012922_heart | 1 .86 RPM | 8 .12 RPM |
| SRP012922_kidney | 3 .29 RPM | 15 .61 RPM |
| SRP012922_liver | 2 .63 RPM | 7 .59 RPM |
| SRP012922_lung | 2 .75 RPM | 10 .08 RPM |
| SRP012922_quadricep_muscle | 2 .42 RPM | 7 .27 RPM |
| SRP012922_spleen | 3 .09 RPM | 8 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004272 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000018923 | 2 retrocopies |
retro_dnov_111 , retro_dnov_651,
|
| Homo sapiens | ENSG00000187118 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012406 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000011702 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000044 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004066 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000012793 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009474 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014054 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000014706 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000010149 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001629 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002573 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011371 | 2 retrocopies |