RetrogeneDB ID: | retro_cjac_3011 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 7:106371050..106371491(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CASP3 | ||
| Ensembl ID: | ENSCJAG00000005740 | ||
| Aliases: | None | ||
| Description: | caspase 3, apoptosis-related cysteine peptidase [Source:HGNC Symbol;Acc:1504] |
| Percent Identity: | 79.05 % |
| Parental protein coverage: | 53.43 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | GTNGPVDLKKITSFFRGDCCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYS |
| GTNGP...KKI.SF.R..CCR.LTGKPKLFIIQ.C..TELD.GIETDSG.DDD..CHKIPVEADFL.AYS | |
| Retrocopy | GTNGPIH*KKI-SFLRVNCCRNLTGKPKLFIIQPCHSTELDPGIETDSGIDDDTKCHKIPVEADFLCAYS |
| Parental | TAPGYYSWRNSRDGSWFIQSLCAMLKLYANKLEFMHILTRVNRKVATEFESSSFDATFHAKKQIPCIVSM |
| ..PGYYS.RNS.DGSWFIQSL.AMLKLY..KLEFMHILTR.N.KV..EFES.S.DATFHAKKQIPC.V.M | |
| Retrocopy | MGPGYYS*RNSKDGSWFIQSLYAMLKLYTDKLEFMHILTRFN*KVGREFESFSLDATFHAKKQIPCVVFM |
| Parental | LTKELYFY |
| LTKELYFY | |
| Retrocopy | LTKELYFY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 14 .20 RPM |
| SRP051959_heart | 0 .02 RPM | 9 .45 RPM |
| SRP051959_kidney | 0 .00 RPM | 10 .69 RPM |
| SRP051959_liver | 0 .00 RPM | 10 .09 RPM |
| SRP051959_lung | 0 .00 RPM | 25 .91 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 48 .99 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 9 .67 RPM |
| SRP051959_spleen | 0 .00 RPM | 19 .71 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005740 | 2 retrocopies |
retro_cjac_2678, retro_cjac_3011 ,
|
| Dasypus novemcinctus | ENSDNOG00000013931 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000002554 | 2 retrocopies | |
| Homo sapiens | ENSG00000164305 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012053 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010895 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015236 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016640 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010475 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009178 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003865 | 2 retrocopies |