RetrogeneDB ID: | retro_dnov_1013 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_135020:241..678(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000013931 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 80.27 % |
| Parental protein coverage: | 52.71 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MENIENSVDSKSIKNSETKISLGSKSV-DSGISLDSSYKMDYPEMGLCIIINNKNFHKSTGMASRSGTDV |
| MENIENS.DSKSIKNSETKI.LGS.S..DS.ISLDSS.K..YPEMGLCIIINNKNFHKSTGMAS.SGTDV | |
| Retrocopy | MENIENSMDSKSIKNSETKILLGSESM<DSRISLDSSCKLGYPEMGLCIIINNKNFHKSTGMASWSGTDV |
| Parental | DAANLRQTFGNLNYQVRNKNDLTREEIMELLRNVSKEDHSKRSSFICVILSHGEEGIIFGTDGPIDLKKL |
| DAANLR.TFGNL.YQ..N.N.LT.EE.MELL.NVSK.D.SK..SFICV.LSHG.EGIIFG..GP.DLKKL | |
| Retrocopy | DAANLRETFGNLKYQGSNRNYLTSEESMELLCNVSKADRSKGRSFICVNLSHGKEGIIFGSNGPLDLKKL |
| Parental | TSFFRGD |
| TSFF.GD | |
| Retrocopy | TSFFGGD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 14 .20 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 6 .60 RPM |
| SRP012922_heart | 0 .00 RPM | 1 .86 RPM |
| SRP012922_kidney | 0 .00 RPM | 5 .20 RPM |
| SRP012922_liver | 0 .00 RPM | 4 .80 RPM |
| SRP012922_lung | 0 .00 RPM | 7 .18 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 4 .15 RPM |
| SRP012922_spleen | 0 .00 RPM | 11 .45 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005740 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000012511 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001797 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000013931 | 1 retrocopy |
retro_dnov_1013 ,
|
| Dipodomys ordii | ENSDORG00000002554 | 2 retrocopies | |
| Homo sapiens | ENSG00000164305 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025155 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000004809 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012053 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010895 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005985 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000015236 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016640 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010475 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009178 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003865 | 2 retrocopies |