RetrogeneDB ID: | retro_cjac_3250 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 9:107888553..107888988(+) | ||
Located in intron of: | ENSCJAG00000009419 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MAGOHB | ||
Ensembl ID: | ENSCJAG00000021662 | ||
Aliases: | None | ||
Description: | mago-nashi homolog B (Drosophila) [Source:HGNC Symbol;Acc:25504] |
Percent Identity: | 72.85 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | MSMASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSE |
..MASDF.LRYY.GHKG..GHEFLEF.F.PD.K.RYA.N...KNDVMI.KEAYVH.SVMEE.K.II.DSE | |
Retrocopy | LTMASDFSLRYYIGHKGRLGHEFLEFKFQPDTKFRYARNNDCKNDVMIKKEAYVHESVMEEPKGII-DSE |
Parental | I-TKEDDALWPPPDRVGRQELE-IVIGDEHISFTTSKIGSLIDVNQSKD-PEGLRVFYYLVQDLKCLVFS |
...K.D....PP.DRVGRQELE.IVIGDEHI.FTT.KIGS..DVNQ.KD..EGLRVFYYLVQDLKC.VFS | |
Retrocopy | T<SKGDALWPPP-DRVGRQELE<IVIGDEHICFTTPKIGSVVDVNQAKD<SEGLRVFYYLVQDLKCSVFS |
Parental | LIGLHFKIKPI |
L.G.HFK.K.I | |
Retrocopy | LPG*HFKLKLI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 2 .84 RPM |
SRP051959_heart | 0 .05 RPM | 2 .35 RPM |
SRP051959_kidney | 0 .00 RPM | 3 .82 RPM |
SRP051959_liver | 0 .00 RPM | 3 .81 RPM |
SRP051959_lung | 0 .08 RPM | 3 .20 RPM |
SRP051959_lymph_node | 0 .00 RPM | 2 .85 RPM |
SRP051959_skeletal_muscle | 0 .28 RPM | 2 .23 RPM |
SRP051959_spleen | 0 .00 RPM | 3 .07 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000004382 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004538 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000021662 | 7 retrocopies |
retro_cjac_1336, retro_cjac_1840, retro_cjac_1858, retro_cjac_2354, retro_cjac_3234, retro_cjac_3250 , retro_cjac_546,
|
Dasypus novemcinctus | ENSDNOG00000005997 | 4 retrocopies | |
Echinops telfairi | ENSETEG00000016591 | 3 retrocopies | |
Homo sapiens | ENSG00000111196 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001782 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005082 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000462 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000003355 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000000548 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000000835 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014820 | 7 retrocopies | |
Tarsius syrichta | ENSTSYG00000010452 | 7 retrocopies |