RetrogeneDB ID: | retro_mmul_1246 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 16:10466490..10466932(-) | ||
| Located in intron of: | ENSMMUG00000004872 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2413 | ||
| Ensembl ID: | ENSMMUG00000005082 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog B [Source:RefSeq peptide;Acc:NP_001252545] |
| Percent Identity: | 87.84 % |
| Parental protein coverage: | 99.32 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | AMASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEI |
| A..SDFYL.YYVGHKGKF.HEFLEFEF.PDGKLR.ANNSN.KNDVMIRKEAYVHKSVMEELK.II.D.EI | |
| Retrocopy | AIQSDFYLHYYVGHKGKFSHEFLEFEF*PDGKLR*ANNSNCKNDVMIRKEAYVHKSVMEELKSIIYDREI |
| Parental | TKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYL-VQDLKCLVFSLIG |
| .KEDDALWPPP..VG.QELEIVIGDEHISFTTSKIGSLIDVNQSKD.EGLRVFYYL..QDLKCLVFSL.G | |
| Retrocopy | IKEDDALWPPPNQVGWQELEIVIGDEHISFTTSKIGSLIDVNQSKDLEGLRVFYYL>AQDLKCLVFSLTG |
| Parental | LHFKIKPI |
| LHFKIKPI | |
| Retrocopy | LHFKIKPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .78 RPM | 2 .47 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .16 RPM | 1 .90 RPM |
| SRP007412_cerebellum | 1 .29 RPM | 3 .42 RPM |
| SRP007412_heart | 0 .12 RPM | 3 .95 RPM |
| SRP007412_kidney | 0 .35 RPM | 2 .46 RPM |
| SRP007412_liver | 0 .28 RPM | 1 .35 RPM |
| SRP007412_testis | 0 .49 RPM | 3 .84 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1803 |
| Pan troglodytes | retro_ptro_1179 |
| Gorilla gorilla | retro_ggor_1326 |
| Pongo abelii | retro_pabe_1479 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019235 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004382 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000021662 | 7 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005997 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000016591 | 3 retrocopies | |
| Homo sapiens | ENSG00000111196 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001782 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003527 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005082 | 1 retrocopy |
retro_mmul_1246 ,
|
| Monodelphis domestica | ENSMODG00000000462 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003355 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000548 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000000635 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000835 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014820 | 7 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010452 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001272 | 2 retrocopies |