RetrogeneDB ID: | retro_cjac_819 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 10:126268718..126268942(-) | ||
Located in intron of: | ENSCJAG00000016951 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HMGN3 | ||
Ensembl ID: | ENSCJAG00000010800 | ||
Aliases: | None | ||
Description: | high mobility group nucleosomal binding domain 3 [Source:HGNC Symbol;Acc:12312] |
Percent Identity: | 93.42 % |
Parental protein coverage: | 75.76 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MPKRKSPENAEGKDGSKVTK-QEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQE |
MPKRKSP.NAEGKDGSKVT..QEPTR.SARLSAKPAPPKPEPKPR.TSAKKEPGAKISRGAKGKKEEKQE | |
Retrocopy | MPKRKSPKNAEGKDGSKVTN<QEPTRWSARLSAKPAPPKPEPKPRNTSAKKEPGAKISRGAKGKKEEKQE |
Parental | AGKEGT |
AGKEGT | |
Retrocopy | AGKEGT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .16 RPM | 3 .66 RPM |
SRP051959_heart | 0 .25 RPM | 29 .94 RPM |
SRP051959_kidney | 0 .09 RPM | 19 .24 RPM |
SRP051959_liver | 0 .26 RPM | 11 .78 RPM |
SRP051959_lung | 0 .20 RPM | 7 .69 RPM |
SRP051959_lymph_node | 0 .11 RPM | 3 .20 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 9 .30 RPM |
SRP051959_spleen | 0 .17 RPM | 10 .92 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011031 | 1 retrocopy | |
Bos taurus | ENSBTAG00000001422 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000002809 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000010800 | 2 retrocopies |
retro_cjac_1626, retro_cjac_819 ,
|
Mustela putorius furo | ENSMPUG00000018092 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016791 | 1 retrocopy |