RetrogeneDB ID: | retro_pabe_421 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 1:99171281..99171472(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN3 | ||
| Ensembl ID: | ENSPPYG00000016791 | ||
| Aliases: | None | ||
| Description: | high mobility group nucleosome-binding domain-containing protein 3 [Source:RefSeq peptide;Acc:NP_001125217] |
| Percent Identity: | 80.0 % |
| Parental protein coverage: | 51.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MPKRKSPENTE-DKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKK |
| M..RKSPEN.E..KDGSKVTKQEPTR.S.RLSAKP.PPKP.PKPR.T.AKKEPGAK.SRGAK.KK | |
| Retrocopy | MQNRKSPENIE<GKDGSKVTKQEPTRWSPRLSAKPPPPKPGPKPRRTFAKKEPGAKVSRGAKEKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .65 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 63 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 69 .78 RPM |
| SRP007412_kidney | 0 .00 RPM | 50 .81 RPM |
| SRP007412_liver | 0 .00 RPM | 25 .71 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_231 |
| Pan troglodytes | retro_ptro_200 |
| Macaca mulatta | retro_mmul_414 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011031 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000001422 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000002809 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010800 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000018092 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016791 | 1 retrocopy |
retro_pabe_421 ,
|