RetrogeneDB ID: | retro_cpor_184 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_1:67758774..67759201(+) | ||
Located in intron of: | ENSCPOG00000015508 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCPOG00000005330 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.75 % |
Parental protein coverage: | 69.76 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | ACMVTIILLLSCDFWTVKNVTGRLMVGLRWWNHIDEDGK-SHWVFESRKATSQESKSF-SEAESRIFWLG |
AC.VTII.LLSCD.W.V.N.TGRLM.GL.WW.H..ED.K.S.WVFE.RKA.SQE.K.F.S.AESRIFWL. | |
Retrocopy | ACTVTIIFLLSCDSWAVNNATGRLMAGLCWWSHTYEDRK>SQWVFEPRKASSQENKVF<SQAESRIFWLS |
Parental | LIACPVLWVIFAFSALFSFR-LKWLAVVIMGVVLQGANLYGYVKCKVGSRKNLTSMATSYLGKQFLRQNT |
.IACP.LW..FA...L.S.R..KWL.VVI.G..L.GA.LYG...C.VGSR..LTSM.T.Y.G.QFLRQNT | |
Retrocopy | VIACPGLWARFALEVLLSLR>VKWLVVVITGLTLHGATLYGCTSCEVGSR-TLTSMVTAYPGTQFLRQNT |
Parental | GDDQTS |
G..QTS | |
Retrocopy | GEAQTS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 5 .75 RPM |
SRP017611_kidney | 0 .00 RPM | 16 .85 RPM |
SRP017611_liver | 0 .00 RPM | 14 .45 RPM |
SRP040447_lung | 0 .00 RPM | 12 .51 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 3 .83 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000005330 | 1 retrocopy |
retro_cpor_184 ,
|
Dasypus novemcinctus | ENSDNOG00000007609 | 2 retrocopies | |
Homo sapiens | ENSG00000171928 | 1 retrocopy | |
Homo sapiens | ENSG00000175106 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000003854 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002825 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019203 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000014658 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000000498 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000012225 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000007790 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000008796 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000050649 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000642 | 6 retrocopies | |
Tarsius syrichta | ENSTSYG00000008082 | 2 retrocopies |