RetrogeneDB ID: | retro_tsyr_530 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_133564:2818..3189(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTSYG00000008082 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.42 % |
| Parental protein coverage: | 60.98 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | NVTGRLMVGLRWWNHIDEDGKSHWVFESRKASSQENKNISE-AEARIFWLGLIACPVLWVIFAF-SALFS |
| NVTGR.MVGL.WWN..DEDGKSHWVFES.KA..QENK.IS..A..RIFWLGLIACPVLW..FA..SA.F. | |
| Retrocopy | NVTGRIMVGLHWWNCTDEDGKSHWVFES*KAFPQENKTISK<AKSRIFWLGLIACPVLWATFAQ<SAFFP |
| Parental | -FRVKWLAVVIMG-VVLQGANLYGYIRCKVGSRKNLTSMATSYLGKQFLKQNTGDDQTS |
| .F.VKWL..VI...VVL.GANL.GYIR..VGSR.NLTS.ATSYLGKQF..QNTGDDQTS | |
| Retrocopy | <FGVKWLVIVITM<VVL*GANLSGYIRHQVGSRNNLTSKATSYLGKQFISQNTGDDQTS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000005330 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007609 | 2 retrocopies | |
| Homo sapiens | ENSG00000171928 | 1 retrocopy | |
| Homo sapiens | ENSG00000175106 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003854 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002825 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019203 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014658 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000000498 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012225 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007790 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008796 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050649 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000642 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008082 | 2 retrocopies |
retro_tsyr_2000, retro_tsyr_530 ,
|