RetrogeneDB ID: | retro_cpor_462 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_16:1619570..1619798(-) | ||
Located in intron of: | ENSCPOG00000013113 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SRP14 | ||
Ensembl ID: | ENSCPOG00000008994 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.83 % |
Parental protein coverage: | 70. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | DGRTRSIPKKGTVEGFEPSDNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKN |
DG.TRSIP.KG.VEGFEP.DN.CLLRAT.G.K..STVVSSK...KFQM.YS.LLRANMD.LKK..KKN.. | |
Retrocopy | DGQTRSIPNKGSVEGFEPLDNMCLLRATHGEK-VSTVVSSKDMSKFQMVYSDLLRANMDRLKKKGKKNNK |
Parental | KKAKTAQ |
.....AQ | |
Retrocopy | DQISIAQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 27 .21 RPM |
SRP017611_kidney | 0 .00 RPM | 27 .74 RPM |
SRP017611_liver | 0 .00 RPM | 18 .32 RPM |
SRP040447_lung | 0 .00 RPM | 25 .70 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 28 .52 RPM |