RetrogeneDB ID: | retro_dnov_2599 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_89307:7891..8044(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRP14 | ||
| Ensembl ID: | ENSDNOG00000011147 | ||
| Aliases: | None | ||
| Description: | signal recognition particle 14kDa (homologous Alu RNA binding protein) [Source:HGNC Symbol;Acc:11299] |
| Percent Identity: | 80.39 % |
| Parental protein coverage: | 66.23 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LLRATDGKKKISTVVSSKEVNKFQMAYSSLLRANMDGLKKRDKKSKSKKTK |
| L.R.TDG.KKISTVVSS.EVNKFQ.AYSSLL.AN..GLKKRDKKSKS.K.K | |
| Retrocopy | LTRTTDGEKKISTVVSSREVNKFQVAYSSLLSANVYGLKKRDKKSKSRKSK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 27 .61 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 29 .56 RPM |
| SRP012922_heart | 0 .00 RPM | 45 .71 RPM |
| SRP012922_kidney | 0 .00 RPM | 39 .43 RPM |
| SRP012922_liver | 0 .00 RPM | 11 .46 RPM |
| SRP012922_lung | 0 .00 RPM | 43 .37 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 40 .85 RPM |
| SRP012922_spleen | 0 .00 RPM | 43 .15 RPM |