RetrogeneDB ID: | retro_pabe_262 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:79764412..79764631(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SRP14 | ||
Ensembl ID: | ENSPPYG00000006342 | ||
Aliases: | None | ||
Description: | Signal recognition particle 14 kDa protein [Source:UniProtKB/Swiss-Prot;Acc:Q5RBX7] |
Percent Identity: | 73.33 % |
Parental protein coverage: | 56.39 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | GRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTK |
G.TKPI.KKG.V.GFE..D..CLLR.TDGKKK.S.V.SSKEVNKF..AYSNLL..NMDGLKKRDKKN.T. | |
Retrocopy | G*TKPILKKGSVVGFESSD-RCLLRTTDGKKKFSIVLSSKEVNKFRVAYSNLLTTNMDGLKKRDKKN-TS |
Parental | KTKAA |
..KAA | |
Retrocopy | NIKAA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .66 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .34 RPM |
SRP007412_heart | 0 .00 RPM | 0 .27 RPM |
SRP007412_kidney | 0 .03 RPM | 0 .56 RPM |
SRP007412_liver | 0 .06 RPM | 0 .34 RPM |