RetrogeneDB ID: | retro_cpor_471 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_16:30959401..30959657(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TM2D1 | ||
| Ensembl ID: | ENSCPOG00000012287 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 54.95 % |
| Parental protein coverage: | 58.55 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | KDPKINDATQEPVNCTNYTAHVPCLPAPNIICKDSSGNETHFTGKEVGFYK-VVPCRNVNGYSYKVAVAL |
| KDP..N.ATQEP.NC.N.TA...C.PA.NI.CKD..GN.THFTG...GF.K......N.NGY..KVA..L | |
| Retrocopy | KDPT-NGATQEPGNCANHTA*LSCCPAHNITCKDFRGNQTHFTGNAGGFLK<TIS*QNINGYVNKVALSL |
| Parental | SLFLGWLGADRFYL-GYPALG |
| .L..GW...D.F.L.GYP..G | |
| Retrocopy | -LLDGWEQTD-FTL<GYPWVG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 10 .70 RPM |
| SRP017611_kidney | 0 .00 RPM | 19 .58 RPM |
| SRP017611_liver | 0 .00 RPM | 15 .84 RPM |
| SRP040447_lung | 0 .00 RPM | 11 .88 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 10 .86 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011705 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000018838 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013535 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012287 | 1 retrocopy |
retro_cpor_471 ,
|
| Equus caballus | ENSECAG00000015035 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000001567 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000013979 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028563 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007527 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002089 | 3 retrocopies |