RetrogeneDB ID: | retro_mmus_1981 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:145892090..145892488(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000083014 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Tm2d1 | ||
| Ensembl ID: | ENSMUSG00000028563 | ||
| Aliases: | Tm2d1, 2310026L18Rik, AA990549, Bbp | ||
| Description: | TM2 domain containing 1 [Source:MGI Symbol;Acc:MGI:2137022] |
| Percent Identity: | 68.57 % |
| Parental protein coverage: | 65.38 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAAAWPAGRASPAAG---PPGLLRTLWLV-TVAAGHCGAAASGAVGGEETPKCEDLRVGQYICKEPKIND |
| .AAAWPA.RA.PA.G...PP.L...L.L...VA.G.CGAAAS.AVGG.ETPKCEDLRVGQYICKEPK.ND | |
| Retrocopy | LAAAWPACRAFPATGSPEPPLLSGALGLL<AVAVGLCGAAAS-AVGGQETPKCEDLRVGQYICKEPKMND |
| Parental | ATQEPVNCTNYTAHVQCFPAPKITCKDLSGNETHFTGSEVGFLKPISCRNVNGYSYKVAVALSLFLGWLG |
| A.Q..VNCTNYTA.VQCFPA....CKDLSGNETHFTG.EVGFLKP.SC.NVNGY.........L...W.G | |
| Retrocopy | AKQDSVNCTNYTARVQCFPA----CKDLSGNETHFTGNEVGFLKPVSCQNVNGY-LAICAEWQLLYSWFG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 9 .63 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .20 RPM |
| SRP007412_heart | 0 .03 RPM | 14 .10 RPM |
| SRP007412_kidney | 0 .00 RPM | 19 .54 RPM |
| SRP007412_liver | 0 .00 RPM | 8 .71 RPM |
| SRP007412_testis | 0 .09 RPM | 4 .12 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011705 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000018838 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013535 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012287 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015035 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000001567 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000013979 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028563 | 2 retrocopies |
retro_mmus_1412, retro_mmus_1981 ,
|
| Rattus norvegicus | ENSRNOG00000007527 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002089 | 3 retrocopies |