RetrogeneDB ID: | retro_cpor_507 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_175:1212777..1213159(-) | ||
| Located in intron of: | ENSCPOG00000004610 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FUNDC1 | ||
| Ensembl ID: | ENSCPOG00000012962 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.23 % |
| Parental protein coverage: | 83.23 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | EYARRHHWWNRVFGHRSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGY |
| .YARRHHWWN.VFGH.SG.MVEKYSVA.QI.M.G.TG.CA.FLFQKVGKLAA..VGGGFL.LQ..SHS.Y | |
| Retrocopy | QYARRHHWWN*VFGHQSGSMVEKYSVAIQILMDGMTGCCAEFLFQKVGKLAA-MVGGGFLPLQTTSHSSY |
| Parental | VQIDWKRVEKDVNKAKRQ-IKKRANKAAPEINNVIEEATEFIKQNIVISSGFVGGFLLGL |
| V.I.WK...K.....KRQ.I.K.ANK...EINNVI...TEFIKQN.V..SGFVGGF.L.L | |
| Retrocopy | V*IKWKS-*KRCKQRKRQ>I*KPANKGVTEINNVIKKLTEFIKQNTVLTSGFVGGFCLVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .06 RPM | 8 .28 RPM |
| SRP017611_kidney | 0 .10 RPM | 7 .96 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .35 RPM |
| SRP040447_lung | 0 .00 RPM | 6 .08 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 6 .18 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010876 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012962 | 2 retrocopies |
retro_cpor_507 , retro_cpor_508,
|
| Echinops telfairi | ENSETEG00000012763 | 3 retrocopies | |
| Homo sapiens | ENSG00000069509 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023311 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000010215 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006795 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000000450 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000003505 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000021088 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002513 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000029753 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000020268 | 2 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000013793 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021821 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000003470 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000000501 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009139 | 1 retrocopy |