RetrogeneDB ID: | retro_mmur_1461 | ||
Retrocopy location | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | scaffold_6436:35718..36060(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FUNDC1 | ||
| Ensembl ID: | ENSMICG00000000450 | ||
| Aliases: | None | ||
| Description: | FUN14 domain containing 1 [Source:HGNC Symbol;Acc:28746] |
| Percent Identity: | 52.63 % |
| Parental protein coverage: | 74.51 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | SYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLL |
| ..E.LDL.E.A....WW...FG..SGP..EKY.VATQ...GGVTGWC.GF.FQKVGKLAATAVGGGF.L. | |
| Retrocopy | NFESLDLAEFAIKQPWWCKLFGQESGPSAEKYRVATQLLIGGVTGWCTGFIFQKVGKLAATAVGGGFFLI |
| Parental | QVASHSGYVQIDWNRVEKDVNKAKRQIKKRANKAAPEINNIIEE |
| Q.A.H.GY...DW.RVE........QI.......A.E....... | |
| Retrocopy | QLANHTGYIKVDWQRVEQLKIRKSNQIPTEVKSKAEEVVSFVKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010876 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012962 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000012763 | 3 retrocopies | |
| Homo sapiens | ENSG00000069509 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023311 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000010215 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006795 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000000450 | 2 retrocopies |
retro_mmur_1189, retro_mmur_1461 ,
|
| Macaca mulatta | ENSMMUG00000003505 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000021088 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002513 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000029753 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000020268 | 2 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000013793 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021821 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000003470 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000000501 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009139 | 1 retrocopy |