RetrogeneDB ID: | retro_dnov_1199 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_162109:687..1031(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000015360 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.39 % |
| Parental protein coverage: | 53.92 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | EKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKE |
| .K..NLTHLNL..NK.KD.ST.EPLKKL..LKSLDLFNCEVTNLNDY.E..F..LPQLTYLDGYD..D.. | |
| Retrocopy | KKLLNLTHLNLNANKLKDISTLEPLKKLDCLKSLDLFNCEVTNLNDYGESIFRVLPQLTYLDGYDQEDPD |
| Parental | -APDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEE |
| ..P...AE..V...D.EE.....E...................EGEE. | |
| Retrocopy | <PPALNAE--VDSMDKEEDEGEDEDXXXXXXXXXXXXXXXXXXEGEED |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .78 RPM | 60 .09 RPM |
| SRP012922_cerebellum | 0 .14 RPM | 53 .89 RPM |
| SRP012922_heart | 0 .70 RPM | 31 .56 RPM |
| SRP012922_kidney | 0 .82 RPM | 56 .40 RPM |
| SRP012922_liver | 0 .62 RPM | 30 .19 RPM |
| SRP012922_lung | 0 .61 RPM | 40 .62 RPM |
| SRP012922_quadricep_muscle | 1 .04 RPM | 27 .69 RPM |
| SRP012922_spleen | 2 .75 RPM | 56 .77 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002339 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000015360 | 5 retrocopies | |
| Felis catus | ENSFCAG00000015773 | 1 retrocopy | |
| Homo sapiens | ENSG00000140350 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015417 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013347 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006595 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007219 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000045651 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000010906 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000016417 | 2 retrocopies |