RetrogeneDB ID: | retro_dnov_2471 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_782:171176..171602(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPB | ||
Ensembl ID: | ENSDNOG00000007896 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptides B and B1 [Source:HGNC Symbol;Acc:11153] |
Percent Identity: | 74.32 % |
Parental protein coverage: | 50.7 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | EEKRVLGLVLLRGENL-VSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGI-PAGVPMPQAPAGLRP |
EEK.VLGLVLL.GENL.VS.TV.GP..KDTGIAR.P.AGA.G..G.G..AGRG..PAGVP.PQ.PAG..P | |
Retrocopy | EEKWVLGLVLLYGENL<VSITVGGPHSKDTGIARLPFAGATGDSGAGMTAGRGV<PAGVPIPQTPAG--P |
Parental | VRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPP-PPMGRGAPPPGMMGPPPGMRPPM |
V.GVGGPS..VMTPQGRGTVAAAA.AATASIAG.PTQYPPG.G.PP.PPMGR..PP.G.M.P.PGMRPPM | |
Retrocopy | V*GVGGPSREVMTPQGRGTVAAAAVAATASIAGVPTQYPPG*GVPP<PPMGRAIPPSGTMAPLPGMRPPM |
Parental | GPPMGIPP |
GPP...PP | |
Retrocopy | GPPTRMPP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 62 .62 RPM |
SRP012922_cerebellum | 0 .27 RPM | 98 .29 RPM |
SRP012922_heart | 0 .00 RPM | 36 .20 RPM |
SRP012922_kidney | 0 .00 RPM | 78 .03 RPM |
SRP012922_liver | 0 .15 RPM | 29 .72 RPM |
SRP012922_lung | 0 .00 RPM | 74 .22 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 41 .19 RPM |
SRP012922_spleen | 0 .00 RPM | 70 .28 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011353 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000006693 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000020971 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007896 | 2 retrocopies |
retro_dnov_2060, retro_dnov_2471 ,
|
Erinaceus europaeus | ENSEEUG00000015568 | 3 retrocopies | |
Felis catus | ENSFCAG00000014447 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000016519 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000016951 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000009283 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000009206 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016149 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000007459 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000010841 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000017013 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000010040 | 3 retrocopies | |
Tarsius syrichta | ENSTSYG00000014498 | 2 retrocopies |