RetrogeneDB ID: | retro_opri_697 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
Coordinates: | scaffold_2463:38095..38536(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPB | ||
Ensembl ID: | ENSOPRG00000007459 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptides B and B1 [Source:HGNC Symbol;Acc:11153] |
Percent Identity: | 50.68 % |
Parental protein coverage: | 51.06 % |
Number of stop codons detected: | 6 |
Number of frameshifts detected | 0 |
Parental | PKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQ |
PKN.KQ.E..EK.V.GLVLL.GE.L.SMTVE.P....TGIARVPL...AGGP...RAA.R.I.AG..... | |
Retrocopy | PKNAKQPEHAEKQVWGLVLLHGESLLSMTVEEPLSIHTGIARVPLGDTAGGPVVDRAA*RNISAGAHF-S |
Parental | APAGLAGPVRGVGGPSQQXXXXXXXGTVAAAA--ATASIAGAPTQYPPG-RAGPPPMGRGAPPPGMMGPP |
.......PV.GVGGPS.Q..........A.AA..ATAS..GA.T.YP.G.R......GR....P.....P | |
Retrocopy | SSFWISRPV*GVGGPSWQLMIP*GIAIRAGAAVVATASLSGAQT*YPSG*RI*TLSIGRLTSTPEITALP |
Parental | PGMRPPMG |
PGMR.P.G | |
Retrocopy | PGMRTPAG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011353 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000006693 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000020971 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007896 | 2 retrocopies | |
Erinaceus europaeus | ENSEEUG00000015568 | 3 retrocopies | |
Felis catus | ENSFCAG00000014447 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000016519 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000016951 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000009283 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000009206 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016149 | 4 retrocopies | |
Ochotona princeps | ENSOPRG00000007459 | 2 retrocopies |
retro_opri_697 , retro_opri_72,
|
Pongo abelii | ENSPPYG00000010841 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000017013 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000010040 | 3 retrocopies | |
Tarsius syrichta | ENSTSYG00000014498 | 2 retrocopies |