RetrogeneDB ID: | retro_eeur_302 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_247066:4452..4691(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSEEUG00000015895 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.78 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSHKQIYYSDKYD-DEEFEYRHVMLP-KDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILL |
| ..H.Q...SD.YD..EEF.YRHV.LP.KDIAKL.PKTHLMSESEWRNLGV.QSQGW.HY.IHEPEPHI.L | |
| Retrocopy | VAHRQTP*SDRYDKEEEFGYRHVILP<KDIAKLAPKTHLMSESEWRNLGVEQSQGWLHYIIHEPEPHISL |
| Parental | FRRPLPKKPKT |
| FR.PLPKKPKT | |
| Retrocopy | FRWPLPKKPKT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .32 RPM | 0 .48 RPM |
| SRP017611_kidney | 0 .56 RPM | 0 .94 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .80 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000033635 | 10 retrocopies | |
| Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000015895 | 1 retrocopy |
retro_eeur_302 ,
|
| Homo sapiens | ENSG00000173207 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013419 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000004796 | 1 retrocopy |