RetrogeneDB ID: | retro_cjac_876 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 11:111061477..111061708(+) | ||
Located in intron of: | ENSCJAG00000020254 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000033635 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 87.34 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
M.HKQIY..DKY..EEFEYRHVML.KDIAKLVPKTHLMSESE.RNLG.QQSQGWVHYMIHEPEPHILLF. | |
Retrocopy | MLHKQIYCLDKY--EEFEYRHVMLTKDIAKLVPKTHLMSESE*RNLGLQQSQGWVHYMIHEPEPHILLFW |
Parental | RPLPKKPKK |
RPLPKK.KK | |
Retrocopy | RPLPKKRKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .38 RPM | 5 .79 RPM |
SRP051959_heart | 0 .28 RPM | 2 .19 RPM |
SRP051959_kidney | 0 .27 RPM | 1 .73 RPM |
SRP051959_liver | 0 .11 RPM | 3 .44 RPM |
SRP051959_lung | 0 .49 RPM | 1 .64 RPM |
SRP051959_lymph_node | 0 .82 RPM | 2 .42 RPM |
SRP051959_skeletal_muscle | 0 .04 RPM | 0 .50 RPM |
SRP051959_spleen | 0 .57 RPM | 4 .92 RPM |