RetrogeneDB ID: | retro_ggor_1070 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 14:78101801..78102038(+) | ||
Located in intron of: | ENSGGOG00000013467 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CKS1B | ||
Ensembl ID: | ENSGGOG00000013419 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 93.67 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
MSHKQI.YSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLG.QQSQGWVHYM.HE.EPHILLFR | |
Retrocopy | MSHKQIHYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGIQQSQGWVHYMTHESEPHILLFR |
Parental | RPLPKKPKK |
RP.PKKPKK | |
Retrocopy | RPPPKKPKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .79 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .34 RPM |
SRP007412_heart | 0 .00 RPM | 1 .69 RPM |
SRP007412_kidney | 0 .08 RPM | 5 .48 RPM |
SRP007412_liver | 0 .00 RPM | 9 .13 RPM |
SRP007412_testis | 0 .21 RPM | 23 .52 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_944 |
Pongo abelii | retro_pabe_1143 |