RetrogeneDB ID: | retro_cjac_1441 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 16:831489..831726(+) | ||
Located in intron of: | ENSCJAG00000013572 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000033635 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 96.2 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
MSHKQIYYSDKYDDEEFEY.HVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHY.IHEPEPHILL.R | |
Retrocopy | MSHKQIYYSDKYDDEEFEY*HVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYVIHEPEPHILLLR |
Parental | RPLPKKPKK |
RPLPKKPKK | |
Retrocopy | RPLPKKPKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .24 RPM | 5 .79 RPM |
SRP051959_heart | 0 .04 RPM | 2 .19 RPM |
SRP051959_kidney | 0 .16 RPM | 1 .73 RPM |
SRP051959_liver | 0 .15 RPM | 3 .44 RPM |
SRP051959_lung | 0 .10 RPM | 1 .64 RPM |
SRP051959_lymph_node | 0 .25 RPM | 2 .42 RPM |
SRP051959_skeletal_muscle | 0 .20 RPM | 0 .50 RPM |
SRP051959_spleen | 0 .13 RPM | 4 .92 RPM |