RetrogeneDB ID: | retro_eeur_359 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_269298:7673..7892(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H2AFV | ||
| Ensembl ID: | ENSEEUG00000015817 | ||
| Aliases: | None | ||
| Description: | H2A histone family, member V [Source:HGNC Symbol;Acc:20664] |
| Percent Identity: | 80.82 % |
| Parental protein coverage: | 54.48 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHK |
| VG.TAA.YS...LEYLTAEVLELAGNASKD.KVK.ITPRHL.LAI.GDEELDSLIKAT.AG.G.IPH.HK | |
| Retrocopy | VGDTAAMYSTVTLEYLTAEVLELAGNASKDRKVKHITPRHL*LAICGDEELDSLIKATKAGSGMIPHMHK |
| Parental | SLM |
| SL. | |
| Retrocopy | SLI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .16 RPM | 7 .41 RPM |
| SRP017611_kidney | 0 .00 RPM | 26 .44 RPM |
| SRP017611_liver | 0 .64 RPM | 13 .67 RPM |