RetrogeneDB ID: | retro_fcat_309 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A2:13295895..13296120(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM2 | ||
| Ensembl ID: | ENSFCAG00000004511 | ||
| Aliases: | None | ||
| Description: | LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:13940] |
| Percent Identity: | 82.67 % |
| Parental protein coverage: | 79.79 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | LFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQ |
| LF.SFFK.LVGKDVVVELKNDLSICGTL..V..YL.IKLTD.SVTDPEK.PH.LSVK.CFIRGSVVR.V. | |
| Retrocopy | LFHSFFKFLVGKDVVVELKNDLSICGTLQRVARYLSIKLTDVSVTDPEK*PHTLSVKDCFIRGSVVRPVR |
| Parental | LPADE |
| LPADE | |
| Retrocopy | LPADE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .36 RPM |
| SRP017611_kidney | 0 .00 RPM | 9 .69 RPM |
| SRP017611_liver | 0 .10 RPM | 4 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002601 | 2 retrocopies | |
| Felis catus | ENSFCAG00000004511 | 1 retrocopy |
retro_fcat_309 ,
|
| Macaca mulatta | ENSMMUG00000006832 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000007050 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006371 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003668 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016461 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017986 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000048725 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013144 | 1 retrocopy |