RetrogeneDB ID: | retro_ggor_2488 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 6:150282236..150282451(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENSG00000197416 | ||
Ensembl ID: | ENSGGOG00000016835 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 58.9 % |
Parental protein coverage: | 51.43 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | EEFEEITSGGHKTKSKVTLDKESLIQVQDWDGKETT-ITRKLVDGKMVVESTVNSVICTRTYEKVSSNSV |
E..EE.T.GGHK.KS..TLD..SLIQVQDWD.KET..I.RKLV..KM.VES.V....C.........NSV | |
Retrocopy | EKCEETTPGGHKIKSTITLDNDSLIQVQDWDHKETS<IGRKLVGEKMGVESAVSNITCAQI*GRE*TNSV |
Parental | SNS |
SNS | |
Retrocopy | SNS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 28 .80 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014554 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000000433 | 1 retrocopy | |
Equus caballus | ENSECAG00000023552 | 1 retrocopy | |
Homo sapiens | ENSG00000197416 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000005964 | 8 retrocopies | |
Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy |
retro_ggor_2488 ,
|
Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002515 | 1 retrocopy | |
Oryzias latipes | ENSORLG00000008282 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy |