RetrogeneDB ID: | retro_amel_945 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192764.1:736937..737170(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP12 | ||
| Ensembl ID: | ENSAMEG00000014554 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 12 [Source:HGNC Symbol;Acc:34524] |
| Percent Identity: | 63.29 % |
| Parental protein coverage: | 55.71 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EISFKLGEEFEETTPGGHKTKSVITFDKDSLIQVQDWDGKENTIRRKLVDGKLVVESAMNNVICTRTYKR |
| EI.FKL.EEFEET...G..T.S..T.D.D.LI.VQ.W.GK...IRRKLVDGK..VES.MNNV.CT.TY.R | |
| Retrocopy | EIFFKLREEFEETVQAGQNTRSTVTLDNDPLI*VQAWAGKATPIRRKLVDGKMGVESTMNNVTCTSTYER |
| Parental | V-QTNSNSN |
| V...NS.SN | |
| Retrocopy | V<IKNSSSN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014554 | 1 retrocopy |
retro_amel_945 ,
|
| Ailuropoda melanoleuca | ENSAMEG00000014619 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000433 | 1 retrocopy | |
| Equus caballus | ENSECAG00000023552 | 1 retrocopy | |
| Homo sapiens | ENSG00000197416 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002515 | 1 retrocopy | |
| Oryzias latipes | ENSORLG00000008282 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy |