RetrogeneDB ID: | retro_mmul_1787 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 4:113988572..113988916(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.19245 | ||
Ensembl ID: | ENSMMUG00000019337 | ||
Aliases: | None | ||
Description: | fatty acid-binding protein 12 [Source:RefSeq peptide;Acc:NP_001181831] |
Percent Identity: | 61.54 % |
Parental protein coverage: | 87.88 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | FEEYLKELGIGRASRKLGCLAKPTVTISTDGDVITIKTKSIFKNSEISFKLGEEFEEITPGGHKTKSKVT |
F.....E.G.GRASRKLGCLAKPTVTIS..GDVITIK.KSIFKN.EI.FK...E.EE.T.GGHK.KS.VT | |
Retrocopy | FTDFVTE-GTGRASRKLGCLAKPTVTISRKGDVITIKMKSIFKNNEIAFKPRNECEETTSGGHKIKSTVT |
Parental | LDKESLIQVQNWDGKETT-ITRKLVDGKMVVESAVNGVICTRTYEKV |
LD..SL..VQ.WD.KET..I.RK.V..KM.VES......C..T.... | |
Retrocopy | LDNDSLAEVQDWDHKETS<IGRKMVGEKMGVESGEQYYLCSETGDRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 58 .09 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014554 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000000433 | 1 retrocopy | |
Equus caballus | ENSECAG00000023552 | 1 retrocopy | |
Homo sapiens | ENSG00000197416 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000486 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000002295 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010906 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy |
retro_mmul_1787 ,
|
Macaca mulatta | ENSMMUG00000021907 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002515 | 1 retrocopy | |
Oryzias latipes | ENSORLG00000008282 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy |