RetrogeneDB ID: | retro_cjac_2486 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 4:150066869..150067168(-) | ||
Located in intron of: | ENSCJAG00000019580 | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000032986 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP12 | ||
Ensembl ID: | ENSCJAG00000000433 | ||
Aliases: | None | ||
Description: | fatty acid binding protein 12 [Source:HGNC Symbol;Acc:34524] |
Percent Identity: | 54.46 % |
Parental protein coverage: | 71.43 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | VTISTDGDVITIKTKSIFKNNEISFKLGEEFEEVTPAGHKTKNKVTLDNESLIQVQDWDGKETTI-TRKL |
..IS..GDVI..K.KSIFKNNEI.FK...EFEE.TP.GHK.K....LDN.SLIQV.DWD.K.T....RKL | |
Retrocopy | LSISRNGDVISTKMKSIFKNNEIAFKPRKEFEETTPGGHKIKSIPPLDNDSLIQVRDWDHKDTPM<GRKL |
Parental | VDGKMVVESTVNNVICTRTYEKVSSNSVSNS |
V..K..V...VNN.......E....NS.S.S | |
Retrocopy | VVEKVGVANAVNNITYAQI*ERE*TNSASIS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 0 .00 RPM |
SRP051959_heart | 0 .00 RPM | 0 .00 RPM |
SRP051959_kidney | 0 .00 RPM | 0 .00 RPM |
SRP051959_liver | 0 .00 RPM | 0 .00 RPM |
SRP051959_lung | 0 .00 RPM | 0 .07 RPM |
SRP051959_lymph_node | 0 .00 RPM | 0 .00 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
SRP051959_spleen | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000014554 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000000433 | 1 retrocopy |
retro_cjac_2486 ,
|
Callithrix jacchus | ENSCJAG00000000444 | 4 retrocopies | |
Equus caballus | ENSECAG00000023552 | 1 retrocopy | |
Homo sapiens | ENSG00000197416 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002515 | 1 retrocopy | |
Oryzias latipes | ENSORLG00000008282 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy |