RetrogeneDB ID: | retro_ggor_3060 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | X:128191044..128191360(-) | ||
Located in intron of: | ENSGGOG00000007569 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TXNL4A | ||
Ensembl ID: | ENSGGOG00000005285 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.3 % |
Parental protein coverage: | 74.65 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | DRVVVIRFGHDWDPTCMKMDE-VLYSIAEKVKNFAVIYLVDITEVPDFNK-MYE-LYDPCTVMFFFRNKH |
DR.V.I.FGH.WDPT.M.M.E.VLY.IAEKVKN..VIYL.DITEV..FNK.MYE.LYD.C.V.F.F.NKH | |
Retrocopy | DRGVIIWFGHNWDPTFMNMNE<VLYCIAEKVKNVVVIYL-DITEVLYFNK>MYE>LYDLCIVIFLFGNKH |
Parental | IMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRG |
IMI...............DKQEMV.IIETVY.G.RK.RG | |
Retrocopy | IMILT*LLATTRLTGPQKDKQEMVNIIETVY*GPRKERG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 45 .27 RPM |
SRP007412_cerebellum | 0 .00 RPM | 24 .43 RPM |
SRP007412_heart | 0 .00 RPM | 28 .74 RPM |
SRP007412_kidney | 0 .04 RPM | 41 .62 RPM |
SRP007412_liver | 0 .00 RPM | 24 .43 RPM |
SRP007412_testis | 0 .00 RPM | 34 .60 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4900 |
Macaca mulatta | retro_mmul_2636 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010130 | 2 retrocopies | |
Homo sapiens | ENSG00000141759 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000005285 | 2 retrocopies |
retro_ggor_1731, retro_ggor_3060 ,
|
Loxodonta africana | ENSLAFG00000003190 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009188 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001613 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008378 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000034753 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000010136 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017596 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000022277 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009428 | 1 retrocopy |