RetrogeneDB ID: | retro_nleu_1268 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397286.1:26001156..26001522(-) | ||
Located in intron of: | ENSNLEG00000015328 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TXNL4A | ||
Ensembl ID: | ENSNLEG00000008378 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 54.4 % |
Parental protein coverage: | 84.51 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | HNGWQ---VDQAILSEEDRVVVIRFGHDWDPTCMKMDE-VLYSIAEKVKNFAVIYLVDITEVPDFNKMYE |
HN.WQ...V........DR.V.I.FGH.WDPT.M.M.E.VL..IAEKVKN..VIYL.DIT......KM.E | |
Retrocopy | HNSWQLAVVSGHTFKRKDRGVIIWFGHNWDPTFMNMNE<VLCYIAEKVKNVVVIYL-DITDYFISTKMCE |
Parental | -LYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRG |
.LYD.C.V.F.F.NKHIMI...............DKQEMV.IIETVY.G.RK.RG | |
Retrocopy | >LYDLCIVIFLFGNKHIMILT*LLVTTRLTGPQKDKQEMVNIIETVY*GPRKERG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010130 | 2 retrocopies | |
Homo sapiens | ENSG00000141759 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000005285 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000003190 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009188 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001613 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008378 | 2 retrocopies |
retro_nleu_1268 , retro_nleu_314,
|
Otolemur garnettii | ENSOGAG00000034753 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000010136 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017596 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000022277 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009428 | 1 retrocopy |