RetrogeneDB ID: | retro_rnor_2458 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 7:53368865..53369114(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Txnl4a | ||
| Ensembl ID: | ENSRNOG00000017596 | ||
| Aliases: | None | ||
| Description: | thioredoxin-like 4A [Source:MGI Symbol;Acc:MGI:1351613] |
| Percent Identity: | 60.71 % |
| Parental protein coverage: | 59.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | FGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNN |
| FGH.W.P.C.K..EVL.S.....K.FAV..L...T.VPDFNK..E.YDP.TVM.FFRNK.I.ID.G.GN. | |
| Retrocopy | FGHYWGPVCIKT-EVLNSMVAEAKQFAVLCLMGTTGVPDFNKTRERYDPRTVMVFFRNKRIKIDFGPGNY |
| Parental | NKINWAMEDKQEMV |
| NKINW..EDKQ..V | |
| Retrocopy | NKINWVIEDKQRIV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 19 .41 RPM |
| SRP017611_kidney | 0 .00 RPM | 17 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010130 | 2 retrocopies | |
| Homo sapiens | ENSG00000141759 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005285 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000003190 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009188 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001613 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008378 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000034753 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010136 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017596 | 2 retrocopies |
retro_rnor_1358, retro_rnor_2458 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000022277 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009428 | 1 retrocopy |