RetrogeneDB ID: | retro_cjac_2805 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 6:38551504..38551907(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TXNL4A | ||
Ensembl ID: | ENSCJAG00000010130 | ||
Aliases: | None | ||
Description: | thioredoxin-like 4A [Source:HGNC Symbol;Acc:30551] |
Percent Identity: | 69.23 % |
Parental protein coverage: | 99.3 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN |
MS..L.HLH..WQVDQ.IL.EED..VVIRF..DWD.TCMKMD.VLYSI.EKVK.FAVI.LVDIT.VPDFN | |
Retrocopy | MSHTLLHLHSSWQVDQPILPEEDHMVVIRFCNDWDSTCMKMDKVLYSIIEKVKDFAVIFLVDITKVPDFN |
Parental | KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKG-RGLVVSPK-DYST |
KMYELYDPCT.....RNKHIMI.LGTG..NKINWA.EDKQEMVDI.......A..G.R.LV...K..YS. | |
Retrocopy | KMYELYDPCTI----RNKHIMIVLGTG--NKINWALEDKQEMVDIRGIMDHRAFNG<RHLVMPSK<NYSM |
Parental | KYR |
KY. | |
Retrocopy | KYK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .02 RPM | 6 .61 RPM |
SRP051959_heart | 0 .02 RPM | 6 .51 RPM |
SRP051959_kidney | 0 .02 RPM | 7 .17 RPM |
SRP051959_liver | 0 .02 RPM | 7 .06 RPM |
SRP051959_lung | 0 .99 RPM | 5 .25 RPM |
SRP051959_lymph_node | 0 .00 RPM | 7 .12 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 11 .79 RPM |
SRP051959_spleen | 0 .00 RPM | 6 .66 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_1663 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010130 | 2 retrocopies |
retro_cjac_2805 , retro_cjac_3659,
|
Homo sapiens | ENSG00000141759 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000005285 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000003190 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009188 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001613 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000008378 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000034753 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000010136 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017596 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000022277 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000009428 | 1 retrocopy |