RetrogeneDB ID: | retro_ggor_367 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:22802053..22802380(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MPHOSPH6 | ||
Ensembl ID: | ENSGGOG00000001405 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 69.91 % |
Parental protein coverage: | 69.38 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKE-KESFIIEEQSFLLCED |
MA.E.KTK.SKNLL.MKFMQRGLDSETKK.LEEEE.K.IS.EHWY.DLPEL......F..EEQ..LLCED | |
Retrocopy | MAPEHKTKFSKNLLHMKFMQRGLDSETKK*LEEEENK-IS*EHWYSDLPELSK<VKNFVTEEQHLLLCED |
Parental | LLYG-RMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSD |
..YG.R.SF..F.PEVEK..LQMN.K.KA.E.EDETVE..VSD | |
Retrocopy | HFYG>RISFIRFTPEVEKSVLQMNTKNKA-EIEDETVEFYVSD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .54 RPM |
SRP007412_cerebellum | 0 .04 RPM | 8 .75 RPM |
SRP007412_heart | 0 .03 RPM | 0 .97 RPM |
SRP007412_kidney | 0 .08 RPM | 7 .28 RPM |
SRP007412_liver | 0 .11 RPM | 4 .83 RPM |
SRP007412_testis | 0 .00 RPM | 10 .36 RPM |
Species | RetrogeneDB ID |
---|---|
Callithrix jacchus | retro_cjac_2976 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000127 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000016498 | 5 retrocopies | |
Dipodomys ordii | ENSDORG00000011060 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000010276 | 6 retrocopies | |
Homo sapiens | ENSG00000135698 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001405 | 1 retrocopy |
retro_ggor_367 ,
|
Macropus eugenii | ENSMEUG00000000580 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000000268 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000022575 | 2 retrocopies | |
Mus musculus | ENSMUSG00000031843 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010725 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000024341 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000012532 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000007592 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000008398 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000050087 | 6 retrocopies | |
Tupaia belangeri | ENSTBEG00000013110 | 8 retrocopies | |
Tarsius syrichta | ENSTSYG00000001928 | 2 retrocopies |